PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011090302.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 629aa    MW: 69964.5 Da    PI: 8.6429
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011090302.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.42.1e-073754121954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ ++++ LA+++gLt +q ++WF N R +
  XP_011090302.1 375 FEHflHPYPKDSDKQMLARQTGLTRSQDSNWFINARVR 412
                     564459******************************88 PP

2BELL102.92.3e-33239310172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +rqe+q+kkakL sll+eV++r +qy++q+q+v++sFe+vag+gsak+Yt+lAlk+i ++FrcLk +i+ qi
  XP_011090302.1 239 QRQEIQMKKAKLSSLLDEVEHRCRQYHHQMQIVVASFEQVAGIGSAKSYTQLALKTILKQFRCLKAKISAQI 310
                     69********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.8E-49168308IPR006563POX domain
PfamPF075262.1E-42173307IPR006563POX domain
PROSITE profilePS5007111.256353416IPR001356Homeobox domain
SMARTSM003891.9E-6356420IPR001356Homeobox domain
CDDcd000867.43E-10356417No hitNo description
SuperFamilySSF466891.75E-14357423IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-26359422IPR009057Homeodomain-like
PfamPF059202.5E-16373412IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 629 aa     Download sequence    Send to blast
MYFQGSSEIQ ADALQTLYLM NPNYVGYSDN HHQPQPNILF SNSATAATVQ ALNPALMHHA  60
PPAQAQHFVG IPLSHDPSRP SSVLGQQEDI QATHSTIPRF QYNIRGLFDQ AATGNQTNVC  120
QQTHQGLSLS LSPHQTGFDH GQSSIRMVSP KNCSSPSLTT TDQTNEVNTM QSVIIGSKYL  180
KAAQELLDEL ANVQKETPIG RPEAGRMDKA KAKAKITKES TVGDEDGNKG GGADLTTAQR  240
QEIQMKKAKL SSLLDEVEHR CRQYHHQMQI VVASFEQVAG IGSAKSYTQL ALKTILKQFR  300
CLKAKISAQI KALNKSLGEE ESFGDKFEGS RLKYVDHQLR QQRALQQLGM VQNSAWRPQR  360
GLPERAVSVL RAWLFEHFLH PYPKDSDKQM LARQTGLTRS QDSNWFINAR VRLWKPMVEE  420
MYLEETKNQE QISASQDNTP KELGSKSNTR PEHNSTRTAR IDHHQQQLND LQSRPILNLQ  480
VPSPTEISAS TVITPATGPT RPGFAQLISP LNTQSPPEKK RRNEAQDNSP SSILSVEMEM  540
KGRETKEDCF PGPYGIGEVG RFNNFQGNNF SLTLALPPSE TSQGAEGQYF LSRVNGMNQA  600
AGSNPGYENI LDFQGRKPFR VQLLPDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B1e-15362420563Homeobox protein Meis2
3k2a_A1e-15362420563Homeobox protein Meis2
4xrm_B1e-15362420563Homeobox protein Meis2
4xrm_A1e-15362420563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090301.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_011090302.10.0PREDICTED: BEL1-like homeodomain protein 1
TrEMBLA0A068V6M00.0A0A068V6M0_COFCA; Uncharacterized protein
STRINGVIT_06s0009g00410.t011e-180(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-108BEL1-like homeodomain 1